PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID GSBRNA2T00079473001
Common NameGSBRNA2T00079473001
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Brassica
Family G2-like
Protein Properties Length: 322aa    MW: 36980.7 Da    PI: 9.1741
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
GSBRNA2T00079473001genomeGenoscopeView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like95.83.3e-30193247256
              G2-like   2 prlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRla 56 
                          +r+rW+++LH+rFv+a++++GGs++AtPk+i++ mkv+gLt+++vkSHLQkYR++
  GSBRNA2T00079473001 193 QRRRWSQDLHRRFVDALRRIGGSQVATPKQIRDEMKVDGLTNDEVKSHLQKYRMH 247
                          8****************************************************96 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129410.919189249IPR017930Myb domain
Gene3DG3DSA:1.10.10.601.1E-26190250IPR009057Homeodomain-like
SuperFamilySSF466894.84E-16190250IPR009057Homeodomain-like
TIGRFAMsTIGR015579.8E-25193247IPR006447Myb domain, plants
PfamPF002491.9E-6194245IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 322 aa     Download sequence    Send to blast
MVQTDKDRRM SLNLNLSMYS IAKPLSQFLD EVSRIKDNHS KLSEIDVYVG KLEEERKKID  60
VFKRELPLCM LLLNEAIERL KEEASSVMMA SNGKLDVGQG SKLENDNKKN WMSSAQLWIS  120
NSNSTNKEED RCVTQTPFQT CNNLNRGGAF LPFKPPPAPL SLMTPMMDCN RTEQNHQFNK  180
PLQSHHHIPK KEQRRRWSQD LHRRFVDALR RIGGSQVATP KQIRDEMKVD GLTNDEVKSH  240
LQKYRMHIRK HPLSSSDQPR ETQSLISLSR SGSPQSPLVG RGLFNNNGSH ISEDDEEEEK  300
SDGRSWRGES DKKRQVVDFE L*
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1188194PKKEQRR
Cis-element ? help Back to Top
SourceLink
PlantRegMapGSBRNA2T00079473001
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankDQ9738391e-119DQ973839.1 Brassica napus clone PBCESTNA15 microsatellite sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_013656621.10.0PREDICTED: uncharacterized protein LOC106361428
TrEMBLA0A078I1W80.0A0A078I1W8_BRANA; BnaA08g15490D protein
STRINGBra010581.1-P0.0(Brassica rapa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM49222652
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G37180.11e-145G2-like family protein
Publications ? help Back to Top
  1. Chalhoub B, et al.
    Plant genetics. Early allopolyploid evolution in the post-Neolithic Brassica napus oilseed genome.
    Science, 2014. 345(6199): p. 950-3
    [PMID:25146293]